• Gene id: 10514

Gene Summary

• Gene Symbol: MYBBP1A   Gene   UCSC   Ensembl
• Aliases: P160, PAP2, Pol5
• Gene name: MYB binding protein 1a
• Alternate names: myb-binding protein 1A, MYB binding protein (P160) 1a, p53-activated protein-2,
• Gene location: 17p13.2 (4555385: 4538895)     Exons: 27     NC_000017.11
• Gene summary(Entrez): This gene encodes a nucleolar transcriptional regulator that was first identified by its ability to bind specifically to the Myb proto-oncogene protein. The encoded protein is thought to play a role in many cellular processes including response to nucleol
• OMIM: 600646

Protein Summary

• Protein general information: Q9BQG0  
  • Name: Myb binding protein 1A
  • Length: 1328  
  • Mass: 148855
• Sequence:

  MESRDPAQPMSPGEATQSGARPADRYGLLKHSREFLDFFWDIAKPEQETRLAATEKLLEYLRGRPKGSEMKYALK
  RLITGLGVGRETARPCYSLALAQLLQSFEDLPLCSILQQIQEKYDLHQVKKAMLRPALFANLFGVLALFQSGRLV
  KDQEALMKSVKLLQALAQYQNHLQEQPRKALVDILSEVSKATLQEILPEVLKADLNIILSSPEQLELFLLAQQKV
  PSKLKKLVGSVNLFSDENVPRLVNVLKMAASSVKKDRKLPAIALDLLRLALKEDKFPRFWKEVVEQGLLKMQFWP
  ASYLCFRLLGAALPLLTKEQLHLVMQGDVIRHYGEHVCTAKLPKQFKFAPEMDDYVGTFLEGCQDDPERQLAVLV
  AFSSVTNQGLPVTPTFWRVVRFLSPPALQGYVAWLRAMFLQPDLDSLVDFSTNNQKKAQDSSLHMPERAVFRLRK
  WIIFRLVSIVDSLHLEMEEALTEQVARFCLFHSFFVTKKPTSQIPETKHPFSFPLENQAREAVSSAFFSLLQTLS
  TQFKQAPGQTQGGQPWTYHLVQFADLLLNHSHNVTTVTPFTAQQRQAWDRMLQTLKELEAHSAEARAAAFQHLLL
  LVGIHLLKSPAESCDLLGDIQTCIRKSLGEKPRRSRTKTIDPQEPPWVEVLVEILLALLAQPSHLMRQVARSVFG
  HICSHLTPRALQLILDVLNPETSEDENDRVVVTDDSDERRLKGAEDKSEEGEDNRSSESEEESEGEESEEEERDG
  DVDQGFREQLMTVLQAGKALGGEDSENEEELGDEAMMALDQSLASLFAEQKLRIQARRDEKNKLQKEKALRRDFQ
  IRVLDLVEVLVTKQPENALVLELLEPLLSIIRRSLRSSSSKQEQDLLHKTARIFTHHLCRARRYCHDLGERAGAL
  HAQVERLVQQAGRQPDSPTALYHFNASLYLLRVLKGNTAEGCVHETQEKQKAGTDPSHMPTGPQAASCLDLNLVT
  RVYSTALSSFLTKRNSPLTVPMFLSLFSRHPVLCQSLLPILVQHITGPVRPRHQACLLLQKTLSMREVRSCFEDP
  EWKQLMGQVLAKVTENLRVLGEAQTKAQHQQALSSLELLNVLFRTCKHEKLTLDLTVLLGVLQGQQQSLQQGAHS
  TGSSRLHDLYWQAMKTLGVQRPKLEKKDAKEIPSATQSPISKKRKKKGFLPETKKRKKRKSEDGTPAEDGTPAAT
  GGSQPPSMGRKKRNRTKAKVPAQANGTPTTKSPAPGAPTRSPSTPAKSPKLQKKNQKPSQVNGAPGSPTEPAGQK
  QHQKALPKKGVLGKSPLSALARKKARLSLVIRSPSLLQSGAKKKAQVRKAGKP

• Structural information:
  • Interpro: IPR016024  IPR007015  
  • STRING: ENSP00000370968
• Other Databases: GeneCards:  MYBBP1A  Malacards:  MYBBP1A

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:2000210	positive regulation of anoikis	IMP	biological process
GO:0003714	transcription corepressor activity	IBA	molecular function
GO:0005730	nucleolus	IBA	cellular component
GO:0043565	sequence-specific DNA binding	IBA	molecular function
GO:0045892	negative regulation of transcription, DNA-templated	ISS	biological process
GO:0003714	transcription corepressor activity	ISS	molecular function
GO:0032922	circadian regulation of gene expression	ISS	biological process
GO:0005730	nucleolus	IEA	cellular component
GO:0003677	DNA binding	IEA	molecular function
GO:0006355	regulation of transcription, DNA-templated	IEA	biological process
GO:0008134	transcription factor binding	IEA	molecular function
GO:0048511	rhythmic process	IEA	biological process
GO:0042254	ribosome biogenesis	IEA	biological process
GO:0005737	cytoplasm	IEA	cellular component
GO:0005634	nucleus	IEA	cellular component
GO:0008134	transcription factor binding	TAS	molecular function
GO:0006355	regulation of transcription, DNA-templated	TAS	biological process
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0045815	positive regulation of gene expression, epigenetic	TAS	biological process
GO:0045892	negative regulation of transcription, DNA-templated	IEA	biological process
GO:0042564	NLS-dependent protein nuclear import complex	IEA	cellular component
GO:0005730	nucleolus	IEA	cellular component
GO:0043565	sequence-specific DNA binding	IEA	molecular function
GO:0070888	E-box binding	IEA	molecular function
GO:0032922	circadian regulation of gene expression	IEA	biological process
GO:0022904	respiratory electron transport chain	IEA	biological process
GO:0005737	cytoplasm	IEA	cellular component
GO:0005634	nucleus	IEA	cellular component
GO:0003714	transcription corepressor activity	IEA	molecular function
GO:0005634	nucleus	IEA	cellular component
GO:0005730	nucleolus	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0005634	nucleus	IEA	cellular component
GO:0043231	intracellular membrane-bounded organelle	IDA	cellular component
GO:0005730	nucleolus	IDA	cellular component
GO:0042149	cellular response to glucose starvation	IDA	biological process
GO:0005730	nucleolus	IDA	cellular component
GO:0005634	nucleus	IDA	cellular component
GO:0016020	membrane	HDA	cellular component
GO:0003723	RNA binding	HDA	molecular function
GO:0005634	nucleus	ISS	cellular component
GO:0001649	osteoblast differentiation	HDA	biological process
GO:0072332	intrinsic apoptotic signaling pathway by p53 class mediator	IMP	biological process
GO:0042564	NLS-dependent protein nuclear import complex	ISS	cellular component
GO:0005730	nucleolus	ISS	cellular component
GO:0016020	membrane	HDA	cellular component
GO:0071158	positive regulation of cell cycle arrest	IMP	biological process
GO:0003723	RNA binding	HDA	molecular function
GO:0005737	cytoplasm	ISS	cellular component

Diseases

Associated diseases	References
Cryptorchidism	MIK: 28606200

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq