Search Result
| Gene id | 10485 | ||||||||||||||||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| Gene Summary Protein Summary Gene ontology Diseases PubMed | |||||||||||||||||||||||||
Gene Summary |
|||||||||||||||||||||||||
| Gene Symbol | MIR9-1HG Gene UCSC Ensembl | ||||||||||||||||||||||||
| Aliases | C1orf61, CROC4 | ||||||||||||||||||||||||
| Gene name | MIR9-1 host gene | ||||||||||||||||||||||||
| Alternate names | protein CROC-4, contingent replication of cDNA 4, transcriptional activator of the c-fos promoter, | ||||||||||||||||||||||||
| Gene location |
1q22 (156456648: 156404251) Exons: 19 NC_000001.11 |
||||||||||||||||||||||||
| OMIM | 159980 | ||||||||||||||||||||||||
Protein Summary |
|||||||||||||||||||||||||
| Protein general information | Q13536 Name: Protein CROC 4 (Contingent replication of cDNA 4) Length: 156 Mass: 17231 Tissue specificity: Expressed throughout the brain in the thalamus, subthalamic nucleus, corpus callosum, hippocampus, substantia nigra, caudate nucleus, and amygdala. {ECO | ||||||||||||||||||||||||
| Sequence |
MFLTEDLITFNLRNFLLFQLWESSFSPGAGGFCTTLPPSFLRVDDRATSSTTDSSRAPSSPRPPGSTSHCGISTR CTERCLCVLPLRTSQVPDVMAPQHDQEKFHDLAYSCLGKSFSMSNQDLYGYSTSSLALGLAWLSWETKKKNVLHL VGLDSL | ||||||||||||||||||||||||
| Structural information |
| ||||||||||||||||||||||||
| Other Databases | GeneCards: MIR9-1HG  Malacards: MIR9-1HG | ||||||||||||||||||||||||
Gene ontology
|
|||||||||||||||||||||||||
| |||||||||||||||||||||||||
Diseases
Expand All | Collapse All |
|||||||||||||||||||||||||
| |||||||||||||||||||||||||
PubMed references
|
|||||||||||||||||||||||||
| |||||||||||||||||||||||||