• Gene id: 1038

Gene Summary

• Gene Symbol: CDR1   Gene   UCSC   Ensembl
• Aliases: CDR, CDR34, CDR62A
• Gene name: cerebellar degeneration related protein 1
• Alternate names: cerebellar degeneration-related antigen 1, cerebellar degeneration-related protein 1, 34kDa,
• Gene location: Xq27.1 (140784557: 140783259)     Exons: 1     NC_000023.11
• Gene summary(Entrez): Autoantibodies directed against the protein encoded by this intronless gene have been found in some patients with paraneoplastic cerebellar degeneration. The encoded protein contains several hexapeptide repeats. [provided by RefSeq, Jan 2010]
• OMIM: 616018

Protein Summary

• Protein general information: P51861  
  • Name: Cerebellar degeneration related antigen 1 (CDR34)
  • Length: 262  
  • Mass: 31279
  • Tissue specificity: Brain; predominantly expressed in normal neuroectodermal tissues and in certain malignant tumors.
• Sequence:

  MAWLEDVDFLEDVPLLEDIPLLEDVPLLEDVPLLEDTSRLEDINLMEDMALLEDVDLLEDTDFLEDLDFSEAMDL
  REDKDFLEDMDSLEDMALLEDVDLLEDTDFLEDPDFLEAIDLREDKDFLEDMDSLEDLEAIGRCGFSGRHGFFGR
  RRFSGRPKLSGRLGLLGRRGFSGRLGGYWKTWIFWKTWIFWKTWIFRKTYIGWKTWIFSGRCGLTGRPGFGGRRR
  FFWKTLTDWKTWISFWKTLIDWKTWISFWKTLIDWKI

• Structural information:
  • STRING: ENSP00000359563
• Other Databases: GeneCards:  CDR1  Malacards:  CDR1

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function

Diseases

Associated diseases	References
Male factor infertility	MIK: 29961538

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
29961538	Male factor infertility			318 (128 couples presenting with OAT (MF) and 118 maternal age-matched control (no MF) subjects undergoing infertility treatment, 72 surplus cryopreserved blastocysts)	Male infertility	RNA-seq