• Gene id: 10326

Gene Summary

• Gene Symbol: SIRPB1   Gene   UCSC   Ensembl
• Aliases: CD172b, SIRP-BETA-1
• Gene name: signal regulatory protein beta 1
• Alternate names: signal-regulatory protein beta-1, CD172 antigen-like family member B,
• Gene location: 20p13 (1620446: 1561384)     Exons: 15     NC_000020.11
• Gene summary(Entrez): The protein encoded by this gene is a member of the signal-regulatory-protein (SIRP) family, and also belongs to the immunoglobulin superfamily. SIRP family members are receptor-type transmembrane glycoproteins known to be involved in the negative regulat
• OMIM: 603889

Protein Summary

• Protein general information: O00241  
  • Name: Signal regulatory protein beta 1 (SIRP beta 1) (CD172 antigen like family member B) (CD antigen CD172b)
  • Length: 398  
  • Mass: 43211
  • Tissue specificity: Detected in monocytes and dendritic cells. {ECO
• Sequence:

  MPVPASWPHLPSPFLLMTLLLGRLTGVAGEDELQVIQPEKSVSVAAGESATLRCAMTSLIPVGPIMWFRGAGAGR
  ELIYNQKEGHFPRVTTVSELTKRNNLDFSISISNITPADAGTYYCVKFRKGSPDDVEFKSGAGTELSVRAKPSAP
  VVSGPAVRATPEHTVSFTCESHGFSPRDITLKWFKNGNELSDFQTNVDPAGDSVSYSIHSTARVVLTRGDVHSQV
  ICEIAHITLQGDPLRGTANLSEAIRVPPTLEVTQQPMRAENQANVTCQVSNFYPRGLQLTWLENGNVSRTETAST
  LIENKDGTYNWMSWLLVNTCAHRDDVVLTCQVEHDGQQAVSKSYALEISAHQKEHGSDITHEAALAPTAPLLVAL
  LLGPKLLLVVGVSAIYICWKQKA

• Structural information:
  • Protein Domains: (30..13-)
    (/note="Ig-like-V-type)
    (147..24-)
    1 (/note="Ig-like-C1-type)
    (253..34-)
    2" (/note="Ig-like-C1-type)
  • Interpro: IPR007110  IPR036179  IPR013783  IPR003597  IPR003599   IPR013106  
  • Prosite: PS50835
  • PDB: 2D9C 2JJU
  • PDBsum: 2D9C 2JJU
  • STRING: ENSP00000371018
• Other Databases: GeneCards:  SIRPB1  Malacards:  SIRPB1
• Protein general information: Q5TFQ8  
  
  Name: Signal regulatory protein beta 1 isoform 3 (SIRP beta 1 isoform 3)
  
  Length: 398  Mass: 43359
• Sequence: MPVPASWPHLPSPFLLMTLLLGRLTGVAGEEELQVIQPDKSISVAAGESATLHCTVTSLIPVGPIQWFRGAGPGR
  ELIYNQKEGHFPRVTTVSDLTKRNNMDFSIRISNITPADAGTYYCVKFRKGSPDHVEFKSGAGTELSVRAKPSAP
  VVSGPAARATPQHTVSFTCESHGFSPRDITLKWFKNGNELSDFQTNVDPAGDSVSYSIHSTAKVVLTREDVHSQV
  ICEVAHVTLQGDPLRGTANLSETIRVPPTLEVTQQPVRAENQVNVTCQVRKFYPQRLQLTWLENGNVSRTETAST
  LTENKDGTYNWMSWLLVNVSAHRDDVKLTCQVEHDGQPAVSKSHDLKVSAHPKEQGSNTAPGPALASAAPLLIAF
  LLGPKVLLVVGVSVIYVYWKQKA
• Structural information:

  Protein Domains	(31..13-) (/note="Ig-like-V-type) (147..24-) 1 (/note="Ig-like-C1-type) (253..34-) 2" (/note="Ig-like-C1-type)
  Interpro:	IPR007110  IPR036179  IPR013783  IPR003597  IPR003599   IPR013106
  Prosite:	PS50835
  PDB:	2JJV
  PDBsum:	2JJV

• Other Databases: GeneCards:  SIRPB1  Malacards:  SIRPB1

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0009986	cell surface	TAS	cellular component
GO:0005886	plasma membrane	IBA	cellular component
GO:0022409	positive regulation of cell-cell adhesion	IBA	biological process
GO:0050766	positive regulation of phagocytosis	IBA	biological process
GO:0050870	positive regulation of T cell activation	IBA	biological process
GO:0005886	plasma membrane	IEA	cellular component
GO:0016021	integral component of membrane	IEA	cellular component
GO:0016020	membrane	IEA	cellular component
GO:0007165	signal transduction	TAS	biological process
GO:0005887	integral component of plasma membrane	TAS	cellular component
GO:0007166	cell surface receptor signaling pathway	TAS	biological process
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0030667	secretory granule membrane	TAS	cellular component
GO:0043312	neutrophil degranulation	TAS	biological process
GO:0045087	innate immune response	TAS	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005886	plasma membrane	IEA	cellular component
GO:0016020	membrane	IEA	cellular component
GO:0016021	integral component of membrane	IEA	cellular component
GO:0016020	membrane	IEA	cellular component

KEGG pathways

Pathway id	Pathway name
hsa04380	Osteoclast differentiation

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881