• Gene id: 10322

Gene Summary

• Gene Symbol: SMYD5   Gene   UCSC   Ensembl
• Aliases: NN8-4AG, RAI15, RRG1, ZMYND23
• Gene name: SMYD family member 5
• Alternate names: SET and MYND domain-containing protein 5, retinoic acid induced 15, retinoic acid responsive, retinoic acid-induced protein 15,
• Gene location: 2p13.2 (73214244: 73227220)     Exons: 13     NC_000002.12
• OMIM: 604525

Protein Summary

• Protein general information: Q6GMV2  
  • Name: SET and MYND domain containing protein 5 (EC 2.1.1. ) (Protein NN8 4AG) (Retinoic acid induced protein 15)
  • Length: 418  
  • Mass: 47341
• Sequence:

  MAASMCDVFSFCVGVAGRARVSVEVRFVSSAKGKGLFATQLIRKGETIFVERPLVAAQFLWNALYRYRACDHCLR
  ALEKAEENAQRLTGKPGQVLPHPELCTVRKDLHQNCPHCQVMYCSAECRLAATEQYHQVLCPGPSQDDPLHPLNK
  LQEAWRSIHYPPETASIMLMARMVATVKQAKDKDRWIRLFSQFCNKTANEEEEIVHKLLGDKFKGQLELLRRLFT
  EALYEEAVSQWFTPDGFRSLFALVGTNGQGIGTSSLSQWVHACDTLELKPQDREQLDAFIDQLYKDIEAATGEFL
  NCEGSGLFVLQSCCNHSCVPNAETSFPENNFLLHVTALEDIKPGEEICISYLDCCQRERSRHSRHKILRENYLFV
  CSCPKCLAEADEPNVTSEEEEEEEEEEEGEPEDAELGDEMTDV

• Structural information:
  • Protein Domains: (21..35-)
    (/note="SET-)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00190"-)
  • Interpro: IPR001214  
  • Prosite: PS50280
  • STRING: ENSP00000374152
• Other Databases: GeneCards:  SMYD5  Malacards:  SMYD5

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0032259	methylation	IEA	biological process
GO:0046872	metal ion binding	IEA	molecular function
GO:0016740	transferase activity	IEA	molecular function
GO:0008168	methyltransferase activity	IEA	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0008150	biological_process	ND	biological process
GO:0003674	molecular_function	ND	molecular function
GO:0005575	cellular_component	ND	cellular component

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881