• Gene id: 10261

Gene Summary

• Gene Symbol: IGSF6   Gene   UCSC   Ensembl
• Aliases: DORA
• Gene name: immunoglobulin superfamily member 6
• Alternate names: immunoglobulin superfamily member 6, down-regulated by activation (immunoglobulin superfamily),
• Gene location: 16p12.2 (21652607: 21639549)     Exons: 8     NC_000016.10
• OMIM: 606222

Protein Summary

• Protein general information: O95976  
  • Name: Immunoglobulin superfamily member 6 (IgSF6) (Protein DORA)
  • Length: 241  
  • Mass: 27013
  • Tissue specificity: Expressed in peripheral blood lymphocytes, spleen and lymph node, with low levels in thymus, bone marrow and fetal liver. No expression in non-immune tissues. {ECO
• Sequence:

  MGTASRSNIARHLQTNLILFCVGAVGACTLSVTQPWYLEVDYTHEAVTIKCTFSATGCPSEQPTCLWFRYGAHQP
  ENLCLDGCKSEADKFTVREALKENQVSLTVNRVTSNDSAIYICGIAFPSVPEARAKQTGGGTTLVVREIKLLSKE
  LRSFLTALVSLLSVYVTGVCVAFILLSKSKSNPLRNKEIKEDSQKKKSARRIFQEIAQELYHKRHVETNQQSEKD
  NNTYENRRVLSNYERP

• Structural information:
  • Protein Domains: (30..13-)
    (/note="Ig-like-C2-type")
  • Interpro: IPR007110  IPR036179  IPR013783  IPR013106  IPR039089  
  • Prosite: PS50835
  • STRING: ENSP00000268389
• Other Databases: GeneCards:  IGSF6  Malacards:  IGSF6

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0016020	membrane	IEA	cellular component
GO:0016021	integral component of membrane	IEA	cellular component
GO:0004888	transmembrane signaling receptor activity	TAS	molecular function
GO:0005887	integral component of plasma membrane	TAS	cellular component
GO:0006955	immune response	TAS	biological process
GO:0007166	cell surface receptor signaling pathway	TAS	biological process
GO:0016020	membrane	IEA	cellular component

Diseases

Associated diseases	References
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)