• Gene id: 10248

Gene Summary

• Gene Symbol: POP7   Gene   UCSC   Ensembl
• Aliases: 0610037N12Rik, RPP2, RPP20
• Gene name: POP7 homolog, ribonuclease P/MRP subunit
• Alternate names: ribonuclease P protein subunit p20, POP7 (processing of precursor, S. cerevisiae) homolog, RNaseP protein p20, hPOP7, processing of precursor 7, ribonuclease P subunit, processing of precursor 7, ribonuclease P/MRP subunit, ribonucleases P/MRP protein subunit P,
• Gene location: 7q22.1 (100706120: 100707485)     Exons: 2     NC_000007.14
• OMIM: 605545

Protein Summary

• Protein general information: O75817  
  • Name: Ribonuclease P protein subunit p20 (RNaseP protein p20) (EC 3.1.26.5) (Ribonucleases P/MRP protein subunit POP7 homolog) (hPOP7)
  • Length: 140  
  • Mass: 15651
• Sequence:

  MAENREPRGAVEAELDPVEYTLRKRLPSRLPRRPNDIYVNMKTDFKAQLARCQKLLDGGARGQNACSEIYIHGLG
  LAINRAINIALQLQAGSFGSLQVAANTSTVELVDELEPETDTREPLTRIRNNSAIHIRVFRVTPK

• Structural information:
  • Interpro: IPR036882  IPR014612  
  • PDB: 6AHR 6AHU 6CWX
  • PDBsum: 6AHR 6AHU 6CWX
  • STRING: ENSP00000304353
• Other Databases: GeneCards:  POP7  Malacards:  POP7

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0008033	tRNA processing	IBA	biological process
GO:0090502	RNA phosphodiester bond hydrolysis, endonucleolytic	IBA	biological process
GO:0005634	nucleus	IBA	cellular component
GO:0004526	ribonuclease P activity	IBA	contributes to
GO:0033204	ribonuclease P RNA binding	IDA	molecular function
GO:0033204	ribonuclease P RNA binding	IDA	molecular function
GO:0005730	nucleolus	IDA	cellular component
GO:0001682	tRNA 5'-leader removal	IDA	biological process
GO:0030681	multimeric ribonuclease P complex	IDA	cellular component
GO:0004526	ribonuclease P activity	IDA	contributes to
GO:0008033	tRNA processing	IEA	biological process
GO:0003676	nucleic acid binding	IEA	molecular function
GO:0004526	ribonuclease P activity	IEA	molecular function
GO:0005634	nucleus	IEA	cellular component
GO:0008033	tRNA processing	IEA	biological process
GO:0016787	hydrolase activity	IEA	molecular function
GO:0005634	nucleus	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0006364	rRNA processing	IEA	biological process
GO:0003723	RNA binding	IEA	molecular function
GO:0004526	ribonuclease P activity	IEA	molecular function
GO:0004526	ribonuclease P activity	IDA	contributes to
GO:0001682	tRNA 5'-leader removal	IDA	biological process
GO:0030681	multimeric ribonuclease P complex	IDA	cellular component
GO:0000172	ribonuclease MRP complex	IDA	cellular component
GO:0001682	tRNA 5'-leader removal	TAS	biological process
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005737	cytoplasm	IEA	cellular component
GO:0005730	nucleolus	IEA	cellular component
GO:0003723	RNA binding	HDA	molecular function

KEGG pathways

Pathway id	Pathway name
hsa03013	RNA transport
hsa03008	Ribosome biogenesis in eukaryotes

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881