• Gene id: 10235

Gene Summary

• Gene Symbol: RASGRP2   Gene   UCSC   Ensembl
• Aliases: CALDAG-GEFI, CDC25L
• Gene name: RAS guanyl releasing protein 2
• Alternate names: RAS guanyl-releasing protein 2, F25B3.3 kinase-like protein, RAS guanyl nucleotide-releasing protein 2, RAS guanyl releasing protein 2 (calcium and DAG-regulated), calcium and DAG-regulated guanine nucleotide exchange factor I, calcium and diacylglycerol-regul,
• Gene location: 11q13.1 (64745480: 64726910)     Exons: 23     NC_000011.10
• Gene summary(Entrez): The protein encoded by this gene is a brain-enriched nucleotide exchanged factor that contains an N-terminal GEF domain, 2 tandem repeats of EF-hand calcium-binding motifs, and a C-terminal diacylglycerol/phorbol ester-binding domain. This protein can act
• OMIM: 605577

Protein Summary

• Protein general information: Q7LDG7  
  • Name: RAS guanyl releasing protein 2 (Calcium and DAG regulated guanine nucleotide exchange factor I) (CalDAG GEFI) (Cdc25 like protein) (hCDC25L) (F25B3.3 kinase like protein)
  • Length: 609  
  • Mass: 69248
  • Tissue specificity: Detected in platelets, neutrophils and T lymphocytes (at protein level). Expressed in brain where it is enriched in the striatum. Also expressed in the hematopoietic system. Detected in heart, brain, lung, placenta, liver, skeletal mus
• Sequence:

  MAGTLDLDKGCTVEELLRGCIEAFDDSGKVRDPQLVRMFLMMHPWYIPSSQLAAKLLHIYQQSRKDNSNSLQVKT
  CHLVRYWISAFPAEFDLNPELAEQIKELKALLDQEGNRRHSSLIDIDSVPTYKWKRQVTQRNPVGQKKRKMSLLF
  DHLEPMELAEHLTYLEYRSFCKILFQDYHSFVTHGCTVDNPVLERFISLFNSVSQWVQLMILSKPTAPQRALVIT
  HFVHVAEKLLQLQNFNTLMAVVGGLSHSSISRLKETHSHVSPETIKLWEGLTELVTATGNYGNYRRRLAACVGFR
  FPILGVHLKDLVALQLALPDWLDPARTRLNGAKMKQLFSILEELAMVTSLRPPVQANPDLLSLLTVSLDQYQTED
  ELYQLSLQREPRSKSSPTSPTSCTPPPRPPVLEEWTSAAKPKLDQALVVEHIEKMVESVFRNFDVDGDGHISQEE
  FQIIRGNFPYLSAFGDLDQNQDGCISREEMVSYFLRSSSVLGGRMGFVHNFQESNSLRPVACRHCKALILGIYKQ
  GLKCRACGVNCHKQCKDRLSVECRRRAQSVSLEGSAPSPSPMHSHHHRAFSFSLPRPGRRGSRPPEIREEEVQTV
  EDGVFDIHL

• Structural information:
  • Protein Domains: (4..12-)
    (/note="N-terminal-Ras-GEF)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00135-)
    (154..38-)
    (/note="Ras-GEF-)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00168-)
    (426..46-)
    (/note="EF-hand-1)
    (/evidence="ECO:0000255|PROSITE-ProRu-)
  • Interpro: IPR011992  IPR018247  IPR002048  IPR002219  IPR008937   IPR000651  IPR023578  IPR001895  IPR036964  
  • Prosite: PS00018 PS50222 PS50009 PS50212 PS00479 PS50081
  • CDD: cd00029 cd00051 cd00155 cd06224
  • PDB: 2MA2 6AXF
  • PDBsum: 2MA2 6AXF
  • STRING: ENSP00000338864
• Other Databases: GeneCards:  RASGRP2  Malacards:  RASGRP2

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0071277	cellular response to calcium ion	IDA	biological process
GO:0043547	positive regulation of GTPase activity	IDA	biological process
GO:0005085	guanyl-nucleotide exchange factor activity	IDA	molecular function
GO:0005509	calcium ion binding	IEA	molecular function
GO:0005085	guanyl-nucleotide exchange factor activity	IEA	molecular function
GO:0007264	small GTPase mediated signal transduction	IEA	biological process
GO:0035556	intracellular signal transduction	IEA	biological process
GO:0030054	cell junction	IEA	cellular component
GO:0046872	metal ion binding	IEA	molecular function
GO:0043005	neuron projection	IEA	cellular component
GO:0042995	cell projection	IEA	cellular component
GO:0005886	plasma membrane	IEA	cellular component
GO:0005085	guanyl-nucleotide exchange factor activity	IEA	molecular function
GO:0045202	synapse	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0016020	membrane	IEA	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0043005	neuron projection	IEA	cellular component
GO:0005829	cytosol	IEA	cellular component
GO:0032587	ruffle membrane	IEA	cellular component
GO:0005886	plasma membrane	IEA	cellular component
GO:0005886	plasma membrane	IDA	cellular component
GO:0005829	cytosol	IDA	cellular component
GO:0019992	diacylglycerol binding	NAS	molecular function
GO:0007165	signal transduction	TAS	biological process
GO:0005509	calcium ion binding	NAS	molecular function
GO:0001558	regulation of cell growth	NAS	biological process
GO:0005085	guanyl-nucleotide exchange factor activity	TAS	molecular function
GO:0008289	lipid binding	TAS	molecular function
GO:0007265	Ras protein signal transduction	NAS	biological process
GO:0005509	calcium ion binding	TAS	molecular function

KEGG pathways

Pathway id	Pathway name
hsa05200	Pathways in cancer
hsa04010	MAPK signaling pathway
hsa04014	Ras signaling pathway
hsa04015	Rap1 signaling pathway
hsa04062	Chemokine signaling pathway
hsa04611	Platelet activation

Diseases

Associated diseases	References
Bleeding disorder platelet-type	KEGG:H01235
Bleeding disorder platelet-type	KEGG:H01235
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)