• Gene id: 10232

Gene Summary

• Gene Symbol: MSLN   Gene   UCSC   Ensembl
• Aliases: MPF, SMRP
• Gene name: mesothelin
• Alternate names: mesothelin, CAK1 antigen, megakaryocyte potentiating factor, pre-pro-megakaryocyte-potentiating factor, soluble MPF mesothelin related protein,
• Gene location: 16p13.3 (760733: 768864)     Exons: 18     NC_000016.10
• Gene summary(Entrez): This gene encodes a preproprotein that is proteolytically processed to generate two protein products, megakaryocyte potentiating factor and mesothelin. Megakaryocyte potentiating factor functions as a cytokine that can stimulate colony formation of bone m
• OMIM: 605153

Protein Summary

• Protein general information: Q13421  
  • Name: Mesothelin (CAK1 antigen) (Pre pro megakaryocyte potentiating factor) [Cleaved into: Megakaryocyte potentiating factor (MPF); Mesothelin, cleaved form]
  • Length: 630  
  • Mass: 68986
  • Tissue specificity: Expressed in lung. Expressed at low levels in heart, placenta and kidney. Expressed in mesothelial cells. Highly expressed in mesotheliomas, ovarian cancers, and some squamous cell carcinomas (at protein level). {ECO
• Sequence:

  MALPTARPLLGSCGTPALGSLLFLLFSLGWVQPSRTLAGETGQEAAPLDGVLANPPNISSLSPRQLLGFPCAEVS
  GLSTERVRELAVALAQKNVKLSTEQLRCLAHRLSEPPEDLDALPLDLLLFLNPDAFSGPQACTRFFSRITKANVD
  LLPRGAPERQRLLPAALACWGVRGSLLSEADVRALGGLACDLPGRFVAESAEVLLPRLVSCPGPLDQDQQEAARA
  ALQGGGPPYGPPSTWSVSTMDALRGLLPVLGQPIIRSIPQGIVAAWRQRSSRDPSWRQPERTILRPRFRREVEKT
  ACPSGKKAREIDESLIFYKKWELEACVDAALLATQMDRVNAIPFTYEQLDVLKHKLDELYPQGYPESVIQHLGYL
  FLKMSPEDIRKWNVTSLETLKALLEVNKGHEMSPQAPRRPLPQVATLIDRFVKGRGQLDKDTLDTLTAFYPGYLC
  SLSPEELSSVPPSSIWAVRPQDLDTCDPRQLDVLYPKARLAFQNMNGSEYFVKIQSFLGGAPTEDLKALSQQNVS
  MDLATFMKLRTDAVLPLTVAEVQKLLGPHVEGLKAEERHRPVRDWILRQRQDDLDTLGLGLQGGIPNGYLVLDLS
  MQEALSGTPCLLGPGPVLTVLALLLASTLA

• Structural information:
  • Interpro: IPR010335  IPR026664  
  • PDB: 4F3F
  • PDBsum: 4F3F
  • STRING: ENSP00000372313
• Other Databases: GeneCards:  MSLN  Malacards:  MSLN

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0009986	cell surface	IBA	cellular component
GO:0007160	cell-matrix adhesion	IBA	biological process
GO:0005794	Golgi apparatus	IEA	cellular component
GO:0005576	extracellular region	IEA	cellular component
GO:0005886	plasma membrane	IEA	cellular component
GO:0031225	anchored component of membrane	IEA	cellular component
GO:0007155	cell adhesion	IEA	biological process
GO:0016020	membrane	IEA	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0044267	cellular protein metabolic process	TAS	biological process
GO:0005576	extracellular region	TAS	cellular component
GO:0005788	endoplasmic reticulum lumen	TAS	cellular component
GO:0043687	post-translational protein modification	TAS	biological process
GO:0005615	extracellular space	IEA	cellular component
GO:0031016	pancreas development	IEA	biological process
GO:0009986	cell surface	IEA	cellular component
GO:0005576	extracellular region	IEA	cellular component
GO:0005794	Golgi apparatus	IEA	cellular component
GO:0005886	plasma membrane	IEA	cellular component
GO:0016020	membrane	NAS	cellular component
GO:0007155	cell adhesion	NAS	biological process
GO:0005515	protein binding	IPI	molecular function

Diseases

Associated diseases	References
pancreatic cancer	PMID:17019794
pancreatic cancer	PMID:17785569
Ovarian cancer	PMID:17785569
Ovarian cancer	PMID:17581599
Pancreas disease	PMID:19843662
pancreatic ductal carcinoma	PMID:19818733
pancreatic ductal carcinoma	PMID:12874021
common bile duct neoplasm	PMID:16416732
bile duct carcinoma	PMID:17276942
Cryptorchidism	MIK: 28606200
Unexplained infertility	MIK: 25753583

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq
25753583	Unexplained infertility			46 (17 fertile men, 29 male patients)	Male infertility	Microarray