• Gene id: 10225

Gene Summary

• Gene Symbol: CD96   Gene   UCSC   Ensembl
• Aliases: TACTILE
• Gene name: CD96 molecule
• Alternate names: T-cell surface protein tactile, T cell activation, increased late expression, cell surface antigen CD96, t cell-activated increased late expression protein,
• Gene location: 3q13.13-q13.2 (111542117: 111665995)     Exons: 19     NC_000003.12
• Gene summary(Entrez): The protein encoded by this gene belongs to the immunoglobulin superfamily. It is a type I membrane protein. The protein may play a role in the adhesive interactions of activated T and NK cells during the late phase of the immune response. It may also fun
• OMIM: 606037

Protein Summary

• Protein general information: P40200  
  • Name: T cell surface protein tactile (Cell surface antigen CD96) (T cell activated increased late expression protein) (CD antigen CD96)
  • Length: 585  
  • Mass: 65634
  • Tissue specificity: Expressed on normal T-cell lines and clones, and some transformed T-cells, but no other cultured cell lines tested. It is expressed at very low levels on activated B-cells.
• Sequence:

  MEKKWKYCAVYYIIQIHFVKGVWEKTVNTEENVYATLGSDVNLTCQTQTVGFFVQMQWSKVTNKIDLIAVYHPQY
  GFYCAYGRPCESLVTFTETPENGSKWTLHLRNMSCSVSGRYECMLVLYPEGIQTKIYNLLIQTHVTADEWNSNHT
  IEIEINQTLEIPCFQNSSSKISSEFTYAWSVENSSTDSWVLLSKGIKEDNGTQETLISQNHLISNSTLLKDRVKL
  GTDYRLHLSPVQIFDDGRKFSCHIRVGPNKILRSSTTVKVFAKPEIPVIVENNSTDVLVERRFTCLLKNVFPKAN
  ITWFIDGSFLHDEKEGIYITNEERKGKDGFLELKSVLTRVHSNKPAQSDNLTIWCMALSPVPGNKVWNISSEKIT
  FLLGSEISSTDPPLSVTESTLDTQPSPASSVSPARYPATSSVTLVDVSALRPNTTPQPSNSSMTTRGFNYPWTSS
  GTDTKKSVSRIPSETYSSSPSGAGSTLHDNVFTSTARAFSEVPTTANGSTKTNHVHITGIVVNKPKDGMSWPVIV
  AALLFCCMILFGLGVRKWCQYQKEIMERPPPFKPPPPPIKYTCIQEPNESDLPYHEMETL

• Structural information:
  • Protein Domains: (38..12-)
    1 (/note="Ig-like-V-type)
    (156..23-)
    2 (/note="Ig-like-V-type)
    (269..37-)
    (/note="Ig-like-C2-type")
  • Interpro: IPR042381  IPR007110  IPR036179  IPR013783  IPR003599  
  • Prosite: PS50835
  • PDB: 6ARQ
  • PDBsum: 6ARQ
  • STRING: ENSP00000283285
• Other Databases: GeneCards:  CD96  Malacards:  CD96

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0007160	cell-matrix adhesion	IBA	biological process
GO:0006954	inflammatory response	IBA	biological process
GO:0016020	membrane	IEA	cellular component
GO:0007155	cell adhesion	IEA	biological process
GO:0016021	integral component of membrane	IEA	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005887	integral component of plasma membrane	TAS	cellular component
GO:0006955	immune response	TAS	biological process
GO:0007155	cell adhesion	TAS	biological process
GO:0007160	cell-matrix adhesion	IDA	biological process
GO:0005737	cytoplasm	IDA	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0050776	regulation of immune response	TAS	biological process
GO:0032689	negative regulation of interferon-gamma production	IEA	biological process
GO:0032496	response to lipopolysaccharide	IEA	biological process
GO:0002534	cytokine production involved in inflammatory response	IEA	biological process
GO:0002728	negative regulation of natural killer cell cytokine production	IEA	biological process
GO:0016020	membrane	IEA	cellular component

Diseases

Associated diseases	References
C syndrome	KEGG:H01008
C syndrome	KEGG:H01008
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)