• Gene id: 10217

Gene Summary

• Gene Symbol: CTDSPL   Gene   UCSC   Ensembl
• Aliases: C3orf8, HYA22, PSR1, RBSP3, SCP3
• Gene name: CTD small phosphatase like
• Alternate names: CTD small phosphatase-like protein, CTD (carboxy-terminal domain, RNA polymerase II, polypeptide A) small phosphatase-like, CTDSP-like, NIF-like protein, NLI-interacting factor 1, RB protein serine phosphatase from chromosome 3, carboxy-terminal domain RNA poly,
• Gene location: 3p22.2 (37861879: 37984468)     Exons: 9     NC_000003.12
• OMIM: 312090

Protein Summary

• Protein general information: O15194  
  • Name: CTD small phosphatase like protein (CTDSP like) (EC 3.1.3.16) (Carboxy terminal domain RNA polymerase II polypeptide A small phosphatase 3) (NIF like protein) (Nuclear LIM interactor interacting factor 1) (NLI interacting factor 1) (Protein YA22) (hYA22)
  • Length: 276  
  • Mass: 31129
  • Tissue specificity: Expression is restricted to non-neuronal tissues. {ECO
• Sequence:

  MDGPAIITQVTNPKEDEGRLPGAGEKASQCNVSLKKQRSRSILSSFFCCFRDYNVEAPPPSSPSVLPPLVEENGG
  LQKGDQRQVIPIPSPPAKYLLPEVTVLDYGKKCVVIDLDETLVHSSFKPISNADFIVPVEIDGTIHQVYVLKRPH
  VDEFLQRMGQLFECVLFTASLAKYADPVADLLDRWGVFRARLFRESCVFHRGNYVKDLSRLGRELSKVIIVDNSP
  ASYIFHPENAVPVQSWFDDMTDTELLDLIPFFEGLSREDDVYSMLHRLCNR

• Structural information:
  • Protein Domains: (102..26-)
    (/note="FCP1-homology)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00336"-)
  • Interpro: IPR011948  IPR004274  IPR036412  IPR023214  IPR040078  
  • Prosite: PS50969
  • PDB: 2HHL
  • PDBsum: 2HHL
  • DIP: 61247
  • STRING: ENSP00000273179
• Other Databases: GeneCards:  CTDSPL  Malacards:  CTDSPL

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0004721	phosphoprotein phosphatase activity	IBA	molecular function
GO:0008420	RNA polymerase II CTD heptapeptide repeat phosphatase activity	IBA	molecular function
GO:0008420	RNA polymerase II CTD heptapeptide repeat phosphatase activity	IEA	molecular function
GO:0016791	phosphatase activity	IEA	molecular function
GO:0004721	phosphoprotein phosphatase activity	IEA	molecular function
GO:0046872	metal ion binding	IEA	molecular function
GO:0016787	hydrolase activity	IEA	molecular function
GO:0005634	nucleus	IEA	cellular component
GO:0004721	phosphoprotein phosphatase activity	IEA	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:2000134	negative regulation of G1/S transition of mitotic cell cycle	IEA	biological process
GO:0001933	negative regulation of protein phosphorylation	IEA	biological process
GO:0005634	nucleus	IEA	cellular component
GO:0016311	dephosphorylation	IEA	biological process
GO:0006470	protein dephosphorylation	IEA	biological process
GO:0006470	protein dephosphorylation	IEA	biological process
GO:0006470	protein dephosphorylation	IEA	biological process
GO:0006470	protein dephosphorylation	IEA	biological process
GO:0006470	protein dephosphorylation	IEA	biological process
GO:0003674	molecular_function	ND	molecular function
GO:0008150	biological_process	ND	biological process
GO:0070062	extracellular exosome	HDA	cellular component
GO:0004721	phosphoprotein phosphatase activity	IBA	molecular function
GO:0008420	RNA polymerase II CTD heptapeptide repeat phosphatase activity	IBA	molecular function
GO:0008420	RNA polymerase II CTD heptapeptide repeat phosphatase activity	IEA	molecular function
GO:0016791	phosphatase activity	IEA	molecular function
GO:0004721	phosphoprotein phosphatase activity	IEA	molecular function
GO:0046872	metal ion binding	IEA	molecular function
GO:0016787	hydrolase activity	IEA	molecular function
GO:0005634	nucleus	IEA	cellular component
GO:0004721	phosphoprotein phosphatase activity	IEA	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:2000134	negative regulation of G1/S transition of mitotic cell cycle	IEA	biological process
GO:0001933	negative regulation of protein phosphorylation	IEA	biological process
GO:0005634	nucleus	IEA	cellular component
GO:0016311	dephosphorylation	IEA	biological process
GO:0006470	protein dephosphorylation	IEA	biological process
GO:0006470	protein dephosphorylation	IEA	biological process
GO:0006470	protein dephosphorylation	IEA	biological process
GO:0006470	protein dephosphorylation	IEA	biological process
GO:0006470	protein dephosphorylation	IEA	biological process
GO:0003674	molecular_function	ND	molecular function
GO:0008150	biological_process	ND	biological process
GO:0070062	extracellular exosome	HDA	cellular component

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881