• Gene id: 10156

Gene Summary

• Gene Symbol: RASA4   Gene   UCSC   Ensembl
• Aliases: CAPRI, GAPL
• Gene name: RAS p21 protein activator 4
• Alternate names: ras GTPase-activating protein 4, Ca2+-promoted Ras inactivator, calcium-promoted Ras inactivator, rasGAP-activating-like protein 2,
• Gene location: 7q22.1 (102616757: 102579645)     Exons: 23     NC_000007.14
• Gene summary(Entrez): This gene encodes a member of the GAP1 family of GTPase-activating proteins that suppresses the Ras/mitogen-activated protein kinase pathway in response to Ca(2+). Stimuli that increase intracellular Ca(2+) levels result in the translocation of this prote
• OMIM: 116901

Protein Summary

• Protein general information: O43374  
  • Name: Ras GTPase activating protein 4 (Calcium promoted Ras inactivator) (Ras p21 protein activator 4) (RasGAP activating like protein 2)
  • Length: 803  
  • Mass: 90458
  • Tissue specificity: Widely expressed. {ECO
• Sequence:

  MAKRSSLYIRIVEGKNLPAKDITGSSDPYCIVKVDNEPIIRTATVWKTLCPFWGEEYQVHLPPTFHAVAFYVMDE
  DALSRDDVIGKVCLTRDTIASHPKGFSGWAHLTEVDPDEEVQGEIHLRLEVWPGARACRLRCSVLEARDLAPKDR
  NGTSDPFVRVRYKGRTRETSIVKKSCYPRWNETFEFELQEGAMEALCVEAWDWDLVSRNDFLGKVVIDVQRLRVV
  QQEEGWFRLQPDQSKSRRHDEGNLGSLQLEVRLRDETVLPSSYYQPLVHLLCHEVKLGMQGPGQLIPLIEETTST
  ECRQDVATNLLKLFLGQGLAKDFLDLLFQLELSRTSETNTLFRSNSLASKSMESFLKVAGMQYLHGVLGPIINKV
  FEEKKYVELDPSKVEVKDVGCSGLHRPQTEAEVLEQSAQTLRAHLGALLSALSRSVRACPAVVRATFRQLFRRVR
  ERFPGAQHENVPFIAVTSFLCLRFFSPAIMSPKLFHLRERHADARTSRTLLLLAKAVQNVGNMDTPASRAKEAWM
  EPLQPTVRQGVAQLKDFITKLVDIEEKDELDLQRTLSLQAPPVKEGPLFIHRTKGKGPLMSSSFKKLYFSLTTEA
  LSFAKTPSSKKSALIKLANIRAAEKVEEKSFGGSHVMQVIYTDDAGRPQTAYLQCKCVNELNQWLSALRKVSINN
  TGLLGSYHPGVFRGDKWSCCHQKEKTGQGCDKTRSRVTLQEWNDPLDHDLEAQLIYRHLLGVEAMLWERHRELSG
  GAEAGTVPTSPGKVPEDSLARLLRVLQDLREAHSSSPAGSPPSEPNCLLELQT

• Structural information:
  • Protein Domains: (1..10-)
    (/note="C2-1)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00041-)
    (116..23-)
    (/note="C2-2)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00041-)
    (302..51-)
    (/note="Ras-GAP-)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00167-)
    (-)
  • Interpro: IPR000008  IPR035892  IPR011993  IPR001849  IPR039360   IPR037777  IPR023152  IPR001936  IPR008936  IPR001562  
  • Prosite: PS50004 PS50003 PS00509 PS50018 PS51113
  • CDD: cd13372
  • STRING: ENSP00000262940
• Other Databases: GeneCards:  RASA4  Malacards:  RASA4

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0034260	negative regulation of GTPase activity	IMP	biological process
GO:0034260	negative regulation of GTPase activity	IDA	biological process
GO:0007165	signal transduction	IEA	biological process
GO:0071277	cellular response to calcium ion	IEA	biological process
GO:0005096	GTPase activator activity	IEA	molecular function
GO:0005543	phospholipid binding	IEA	molecular function
GO:0035556	intracellular signal transduction	IEA	biological process
GO:0043087	regulation of GTPase activity	IEA	biological process
GO:0046580	negative regulation of Ras protein signal transduction	IEA	biological process
GO:0046872	metal ion binding	IEA	molecular function
GO:0016020	membrane	IEA	cellular component
GO:0005096	GTPase activator activity	IEA	molecular function
GO:0005737	cytoplasm	IEA	cellular component
GO:0005886	plasma membrane	IEA	cellular component
GO:0000165	MAPK cascade	TAS	biological process
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	IEA	cellular component
GO:0005886	plasma membrane	IEA	cellular component
GO:0043547	positive regulation of GTPase activity	IEA	biological process
GO:0043547	positive regulation of GTPase activity	IEA	biological process
GO:0043547	positive regulation of GTPase activity	IEA	biological process
GO:0043547	positive regulation of GTPase activity	IEA	biological process
GO:0005096	GTPase activator activity	IDA	molecular function
GO:0005096	GTPase activator activity	IDA	molecular function
GO:0005829	cytosol	IDA	cellular component
GO:0005886	plasma membrane	IDA	colocalizes with
GO:0071277	cellular response to calcium ion	IMP	biological process

KEGG pathways

Pathway id	Pathway name
hsa04014	Ras signaling pathway

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881