• Gene id: 10107

Gene Summary

• Gene Symbol: TRIM10   Gene   UCSC   Ensembl
• Aliases: HERF1, RFB30, RNF9
• Gene name: tripartite motif containing 10
• Alternate names: tripartite motif-containing protein 10, B30-RING finger protein, Zn-finger protein, hematopoietic RING finger 1, ring finger protein 9, tripartite motif protein 10,
• Gene location: 6p22.1 (30163215: 30151938)     Exons: 10     NC_000006.12
• Gene summary(Entrez): The protein encoded by this gene is a member of the tripartite motif (TRIM) family. The TRIM motif includes three zinc-binding domains, a RING, a B-box type 1 and a B-box type 2, and a coiled-coil region. This protein localizes to cytoplasmic bodies. Stud
• OMIM: 605701

Protein Summary

• Protein general information: Q9UDY6  
  • Name: Tripartite motif containing protein 10 (B30 RING finger protein) (RING finger protein 9)
  • Length: 481  
  • Mass: 55037
• Sequence:

  MASAASVTSLADEVNCPICQGTLREPVTIDCGHNFCRACLTRYCEIPGPDLEESPTCPLCKEPFRPGSFRPNWQL
  ANVVENIERLQLVSTLGLGEEDVCQEHGEKIYFFCEDDEMQLCVVCREAGEHATHTMRFLEDAAAPYREQIHKCL
  KCLRKEREEIQEIQSRENKRMQVLLTQVSTKRQQVISEFAHLRKFLEEQQSILLAQLESQDGDILRQRDEFDLLV
  AGEICRFSALIEELEEKNERPARELLTDIRSTLIRCETRKCRKPVAVSPELGQRIRDFPQQALPLQREMKMFLEK
  LCFELDYEPAHISLDPQTSHPKLLLSEDHQRAQFSYKWQNSPDNPQRFDRATCVLAHTGITGGRHTWVVSIDLAH
  GGSCTVGVVSEDVQRKGELRLRPEEGVWAVRLAWGFVSALGSFPTRLTLKEQPRQVRVSLDYEVGWVTFTNAVTR
  EPIYTFTASFTRKVIPFFGLWGRGSSFSLSS

• Structural information:
  • Protein Domains: (292..48-)
    (/note="B30.2/SPRY-)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00548"-)
  • Interpro: IPR001870  IPR003879  IPR013320  IPR006574  IPR003877   IPR042784  IPR000315  IPR001841  IPR013083  IPR017907  
  • Prosite: PS50188 PS50119 PS00518 PS50089
  • CDD: cd00021 cd16593
  • STRING: ENSP00000397073
• Other Databases: GeneCards:  TRIM10  Malacards:  TRIM10

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0061630	ubiquitin protein ligase activity	IBA	molecular function
GO:0045087	innate immune response	IBA	biological process
GO:0016567	protein ubiquitination	IBA	biological process
GO:0010468	regulation of gene expression	IBA	biological process
GO:0005737	cytoplasm	IBA	cellular component
GO:0008270	zinc ion binding	IEA	molecular function
GO:0046872	metal ion binding	IEA	molecular function
GO:0005737	cytoplasm	IEA	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0046597	negative regulation of viral entry into host cell	IEA	biological process
GO:0005737	cytoplasm	IEA	cellular component
GO:0045087	innate immune response	IEA	biological process
GO:0030218	erythrocyte differentiation	IEA	biological process
GO:0005737	cytoplasm	IEA	cellular component
GO:0005737	cytoplasm	ISS	cellular component
GO:0003674	molecular_function	ND	molecular function
GO:0008150	biological_process	ND	biological process

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Teratozoospermia	MIK: 17327269
Unexplained infertility	MIK: 25753583

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881
25753583	Unexplained infertility			46 (17 fertile men, 29 male patients)	Male infertility	Microarray