• Gene id: 10099

Gene Summary

• Gene Symbol: TSPAN3   Gene   UCSC   Ensembl
• Aliases: TM4-A, TM4SF8, TSPAN-3
• Gene name: tetraspanin 3
• Alternate names: tetraspanin-3, tetraspan 3, tetraspan TM4SF, tetraspanin TM4-A, transmembrane 4 superfamily member 8,
• Gene location: 15q24.3 (77071108: 77041403)     Exons: 7     NC_000015.10
• Gene summary(Entrez): The protein encoded by this gene is a member of the transmembrane 4 superfamily, also known as the tetraspanin family. Most of these members are cell-surface proteins that are characterized by the presence of four hydrophobic domains. The proteins mediate
• OMIM: 613134

Protein Summary

• Protein general information: O60637  
  • Name: Tetraspanin 3 (Tspan 3) (Tetraspanin TM4 A) (Transmembrane 4 superfamily member 8)
  • Length: 253  
  • Mass: 28018
• Sequence:

  MGQCGITSSKTVLVFLNLIFWGAAGILCYVGAYVFITYDDYDHFFEDVYTLIPAVVIIAVGALLFIIGLIGCCAT
  IRESRCGLATFVIILLLVFVTEVVVVVLGYVYRAKVENEVDRSIQKVYKTYNGTNPDAASRAIDYVQRQLHCCGI
  HNYSDWENTDWFKETKNQSVPLSCCRETASNCNGSLAHPSDLYAEGCEALVVKKLQEIMMHVIWAALAFAAIQLL
  GMLCACIVLCRRSRDPAYELLITGGTYA

• Structural information:
  • Interpro: IPR000301  IPR018499  IPR018503  IPR008952  
  • Prosite: PS00421
  • STRING: ENSP00000267970
• Other Databases: GeneCards:  TSPAN3  Malacards:  TSPAN3

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0016477	cell migration	IBA	biological process
GO:0005887	integral component of plasma membrane	IBA	cellular component
GO:0016021	integral component of membrane	IEA	cellular component
GO:0016020	membrane	IEA	cellular component
GO:0016021	integral component of membrane	IEA	cellular component
GO:0016020	membrane	IEA	cellular component
GO:0070062	extracellular exosome	HDA	cellular component
GO:0008150	biological_process	ND	biological process
GO:0003674	molecular_function	ND	molecular function

Diseases

Associated diseases	References
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)