|
Gene id |
100507027 |
| Gene Summary Protein Summary Gene ontology Diseases PubMed |
Gene Summary
|
|
Gene Symbol |
MRLN Gene UCSC Ensembl |
|
Aliases |
LINC00948, Linc-RAM, M1, MLN, MUSER1 |
|
Gene name |
myoregulin |
|
Alternate names |
myoregulin, Linc-RNA activator of myogenesis, long intergenic non-protein coding RNA 948, muscle enriched RNA 1, muscle specific 1, |
|
Gene location |
10q21.2 (59753454: 59736691) Exons: 4 NC_000010.11
|
|
Gene summary(Entrez) |
This gene encodes a small peptide that shares structural similarity to the small peptides sarcolipin and phospholamban, which are key regulators of sarcoplasmic reticulum Ca(2+)-ATPases (SERCAs). This protein is thought to have a similar function to these
|
|
OMIM |
616246 |
Protein Summary
|
| Protein general information
| P0DMT0
Name: Myoregulin
Length: 46 Mass: 5194
|
| Sequence |
MTGKNWILISTTTPKSLEDEIVGRLLKILFVIFVDLISIIYVVITS
|
| Structural information |
|
| Other Databases |
GeneCards: MRLN  Malacards: MRLN |
|
| GO accession | Term name | Evidence code | Go category |
|---|
| GO:0004857 |
enzyme inhibitor activity
|
ISS |
molecular function |
GO:0033017 |
sarcoplasmic reticulum me mbrane
|
ISS |
cellular component |
GO:1902081 |
negative regulation of ca lcium ion import into sar coplasmic reticulum
|
ISS |
biological process |
GO:0016529 |
sarcoplasmic reticulum
|
IEA |
cellular component |
GO:0016021 |
integral component of mem brane
|
IEA |
cellular component |
GO:0016020 |
membrane
|
IEA |
cellular component |
GO:0033017 |
sarcoplasmic reticulum me mbrane
|
IEA |
cellular component |
GO:0043086 |
negative regulation of ca talytic activity
|
IEA |
biological process |
|
|
| Associated diseases |
References |
| Teratozoospermia | MIK: 17327269 |
|
|
| PMID |
Condition |
Mutation |
Ethnicity |
Population details |
Infertility_type |
Associated_genes |
Abstract |
| 17327269 |
Teratozoos permia
|
|
|
19 (6 controls , 13 cases)
|
Male infertility |
GSE6872 analyzed by GEO2R (cutoff 1.5 fold)
|
Show abstract |
|