• Gene id: 100505385

Gene Summary

• Gene Symbol: IQCJ-SCHIP1   Gene   UCSC   Ensembl
• Gene name: IQCJ-SCHIP1 readthrough
• Alternate names: IQCJ-SCHIP1 readthrough transcript protein, IQ motif containing J-schwannomin interacting protein 1 fusion protein, IQ motif containing J-schwannomin interacting protein 1 read-through transcript,
• Gene location: 3q25.32-q25.33 (159069251: 159897365)     Exons: 11     NC_000003.12
• Gene summary(Entrez): This locus represents naturally occurring read-through transcription from the neighboring IQ motif containing J (IQCJ) and schwannomin interacting protein 1 (SCHIP1) genes. Alternative splicing results in multiple transcript variants that are composed of
• OMIM: 613998

Protein Summary

• Protein general information: B3KU38  
  • Name: IQCJ SCHIP1 readthrough transcript protein
  • Length: 563  
  • Mass: 62248
  • Tissue specificity: Highly expressed in brain and to a lower extent in heart and kidney. {ECO
• Sequence:

  MRLEELKRLQNPLEQVNDGKYSFENHQLAMDAENNIEKYPLNLQPLESKVKIIQRAWREYLQRQEPLGKRSPSPP
  SVSSEKLSSSVSMNTFSDSSTPDYREDGMDLGSDAGSSSSSSRASSQSNSTKVTPCSECKSSSSPGGSLDLVSAL
  EDYEEPFPVYQKKVIDEWAPEEDGEEEEEEDERDQRGYRDDRSPAREPGDVSARTRSGGGGGRSATTAMPPPVPN
  GNLHQHDPQDLRHNGNVVVAGRPSCSRGPRRAIQKPQPAGGRRSGRGPAAGGLCLQPPDGGTCVPEEPPVPPMDW
  EALEKHLAGLQFREQEVRNQGQARTNSTSAQKNERESIRQKLALGSFFDDGPGIYTSCSKSGKPSLSSRLQSGMN
  LQICFVNDSGSDKDSDADDSKTETSLDTPLSPMSKQSSSYSDRDTTEEESESLDDMDFLTRQKKLQAEAKMALAM
  AKPMAKMQVEVEKQNRKKSPVADLLPHMPHISECLMKRSLKPTDLRDMTIGQLQVIVNDLHSQIESLNEELVQLL
  LIRDELHTEQDAMLVDIEDLTRHAESQQKHMAEKMPAK

• Structural information:
  • Protein Domains: (47..6-)
    (/note="IQ"-)
  • Interpro: IPR029362  IPR039045  IPR015649  
  • STRING: ENSP00000420182
• Other Databases: GeneCards:  IQCJ-SCHIP1  Malacards:  IQCJ-SCHIP1

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0042995	cell projection	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0030424	axon	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0051494	negative regulation of cytoskeleton organization	IMP	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0043194	axon initial segment	ISS	cellular component

Diseases

Associated diseases	References
Unexplained infertility	MIK: 25753583

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
25753583	Unexplained infertility			46 (17 fertile men, 29 male patients)	Male infertility	Microarray