Search Result
| Gene id | 100423062 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| Gene Summary Protein Summary Gene ontology Diseases PubMed | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Gene Summary |
|||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Gene Symbol | IGLL5 Gene UCSC Ensembl | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Aliases | IGL, IGLV, VL-MAR | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Gene name | immunoglobulin lambda like polypeptide 5 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Alternate names | immunoglobulin lambda-like polypeptide 5, G lambda-1, anti HBs antibody light-chain Fab fragment, germline immunoglobulin lambda 1, immunoglobin anti-granzymeB light chain variable region, immunoglobulin lambda 1 light chain, immunoglobulin lambda 2 light chain, | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Gene location |
22q11.22 (22887815: 22896110) Exons: 1 NC_000022.11 |
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Gene summary(Entrez) |
This gene encodes one of the immunoglobulin lambda-like polypeptides. It is located within the immunoglobulin lambda locus but it does not require somatic rearrangement for expression. The first exon of this gene is unrelated to immunoglobulin variable ge |
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Protein Summary |
|||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Protein general information | B9A064 Name: Immunoglobulin lambda like polypeptide 5 (G lambda 1) (Germline immunoglobulin lambda 1) Length: 214 Mass: 23063 Tissue specificity: Contrary to IGLL1, not expressed in pre-B-cells. {ECO | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Sequence |
MRPKTGQVGCETPEELGPGPRQRWPLLLLGLAMVAHGLLRPMVAPQSGDPDPGASVGSSRSSLRSLWGRLLLQPS PQRADPRCWPRGFWSEPQSLCYVFGTGTKVTVLGQPKANPTVTLFPPSSEELQANKATLVCLISDFYPGAVTVAW KADGSPVKAGVETTKPSKQSNNKYAASSYLSLTPEQWKSHRSYSCQVTHEGSTVEKTVAPTECS | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Structural information |
| ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Other Databases | GeneCards: IGLL5  Malacards: IGLL5 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Gene ontology
|
|||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Diseases
Expand All | Collapse All |
|||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
PubMed references
|
|||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||