• Gene id: 10039

Gene Summary

• Gene Symbol: PARP3   Gene   UCSC   Ensembl
• Aliases: ADPRT3, ADPRTL2, ADPRTL3, ARTD3, IRT1, PADPRT-3
• Gene name: poly(ADP-ribose) polymerase family member 3
• Alternate names: protein mono-ADP-ribosyltransferase PARP3, ADP-ribosyltransferase (NAD+; poly (ADP-ribose) polymerase)-like 2, ADP-ribosyltransferase (NAD+; poly (ADP-ribose) polymerase)-like 3, ADP-ribosyltransferase diphtheria toxin-like 3, ADPRT-3, DNA ADP-ribosyltransfera,
• Gene location: 3p21.2 (51942289: 51948866)     Exons: 12     NC_000003.12
• Gene summary(Entrez): The protein encoded by this gene belongs to the PARP family. These enzymes modify nuclear proteins by poly-ADP-ribosylation, which is required for DNA repair, regulation of apoptosis, and maintenance of genomic stability. This gene encodes the poly(ADP-ri
• OMIM: 607726

Protein Summary

• Protein general information: Q9Y6F1  
  • Name: Protein mono ADP ribosyltransferase PARP3 (EC 2.4.2. ) (ADP ribosyltransferase diphtheria toxin like 3) (ARTD3) (DNA ADP ribosyltransferase PARP3) (EC 2.4.2. ) (IRT1) (NAD(+) ADP ribosyltransferase 3) (ADPRT 3) (Poly [ADP ribose] polymerase 3) (PARP 3) (h
  • Length: 533  
  • Mass: 60089
  • Tissue specificity: Widely expressed; the highest levels are in the kidney, skeletal muscle, liver, heart and spleen; also detected in pancreas, lung, placenta, brain, leukocytes, colon, small intestine, ovary, testis, prostate and thymus. {ECO
• Sequence:

  MAPKPKPWVQTEGPEKKKGRQAGREEDPFRSTAEALKAIPAEKRIIRVDPTCPLSSNPGTQVYEDYNCTLNQTNI
  ENNNNKFYIIQLLQDSNRFFTCWNRWGRVGEVGQSKINHFTRLEDAKKDFEKKFREKTKNNWAERDHFVSHPGKY
  TLIEVQAEDEAQEAVVKVDRGPVRTVTKRVQPCSLDPATQKLITNIFSKEMFKNTMALMDLDVKKMPLGKLSKQQ
  IARGFEALEALEEALKGPTDGGQSLEELSSHFYTVIPHNFGHSQPPPINSPELLQAKKDMLLVLADIELAQALQA
  VSEQEKTVEEVPHPLDRDYQLLKCQLQLLDSGAPEYKVIQTYLEQTGSNHRCPTLQHIWKVNQEGEEDRFQAHSK
  LGNRKLLWHGTNMAVVAAILTSGLRIMPHSGGRVGKGIYFASENSKSAGYVIGMKCGAHHVGYMFLGEVALGREH
  HINTDNPSLKSPPPGFDSVIARGHTEPDPTQDTELELDGQQVVVPQGQPVPCPEFSSSTFSQSEYLIYQESQCRL
  RYLLEVHL

• Structural information:
  • Protein Domains: (182..30-)
    (/note="PARP-alpha-helical)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00398-)
    (313..53-)
    (/note="PARP-catalytic)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00397"-)
  • Interpro: IPR031275  IPR012317  IPR004102  IPR036616  IPR036930   IPR008893  
  • Prosite: PS51060 PS51059
  • PDB: 2EOC 3C49 3C4H 3CE0 3FHB 4GV0 4GV2 4GV4 4L6Z 4L70 4L7L 4L7N 4L7O 4L7P 4L7R 4L7U
  • PDBsum: 2EOC 3C49 3C4H 3CE0 3FHB 4GV0 4GV2 4GV4 4L6Z 4L70 4L7L 4L7N 4L7O 4L7P 4L7R 4L7U
  • STRING: ENSP00000381740
• Other Databases: GeneCards:  PARP3  Malacards:  PARP3

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0005730	nucleolus	IBA	cellular component
GO:1990404	protein ADP-ribosylase activity	IBA	molecular function
GO:0003950	NAD+ ADP-ribosyltransferase activity	IBA	molecular function
GO:0005634	nucleus	IBA	cellular component
GO:0006302	double-strand break repair	IBA	biological process
GO:0035861	site of double-strand break	IBA	cellular component
GO:0070212	protein poly-ADP-ribosylation	IBA	biological process
GO:0140289	protein mono-ADP-ribosylation	IDA	biological process
GO:1990404	protein ADP-ribosylase activity	IDA	molecular function
GO:2001034	positive regulation of double-strand break repair via nonhomologous end joining	IDA	biological process
GO:0006471	protein ADP-ribosylation	IDA	biological process
GO:1990404	protein ADP-ribosylase activity	IDA	molecular function
GO:1990404	protein ADP-ribosylase activity	IDA	molecular function
GO:0140289	protein mono-ADP-ribosylation	IDA	biological process
GO:0030592	DNA ADP-ribosylation	IDA	biological process
GO:0070213	protein auto-ADP-ribosylation	IDA	biological process
GO:0140294	NAD DNA ADP-ribosyltransferase activity	IDA	molecular function
GO:0045829	negative regulation of isotype switching	ISS	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0006471	protein ADP-ribosylation	IEA	biological process
GO:0003950	NAD+ ADP-ribosyltransferase activity	IEA	molecular function
GO:0006302	double-strand break repair	IEA	biological process
GO:0006281	DNA repair	IEA	biological process
GO:0016740	transferase activity	IEA	molecular function
GO:0006974	cellular response to DNA damage stimulus	IEA	biological process
GO:0005694	chromosome	IEA	cellular component
GO:0005856	cytoskeleton	IEA	cellular component
GO:0005634	nucleus	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0016757	transferase activity, transferring glycosyl groups	IEA	molecular function
GO:0003824	catalytic activity	TAS	molecular function
GO:0006281	DNA repair	TAS	biological process
GO:0006471	protein ADP-ribosylation	TAS	biological process
GO:0006471	protein ADP-ribosylation	IDA	biological process
GO:0035861	site of double-strand break	IDA	cellular component
GO:0006302	double-strand break repair	IDA	biological process
GO:0003950	NAD+ ADP-ribosyltransferase activity	IDA	molecular function
GO:0003950	NAD+ ADP-ribosyltransferase activity	IDA	molecular function
GO:0051106	positive regulation of DNA ligation	IGI	biological process
GO:0000723	telomere maintenance	IMP	biological process
GO:1990166	protein localization to site of double-strand break	IMP	biological process
GO:0060236	regulation of mitotic spindle organization	IMP	biological process
GO:0006302	double-strand break repair	IMP	biological process
GO:0045829	negative regulation of isotype switching	IEA	biological process
GO:0035861	site of double-strand break	IEA	cellular component
GO:0006302	double-strand break repair	IEA	biological process
GO:1905662	negative regulation of telomerase RNA reverse transcriptase activity	IMP	biological process
GO:0005815	microtubule organizing center	IEA	cellular component
GO:0005634	nucleus	IEA	cellular component
GO:0005814	centriole	IEA	cellular component
GO:0005694	chromosome	IEA	cellular component
GO:0005654	nucleoplasm	IDA	cellular component
GO:0016604	nuclear body	IDA	cellular component

KEGG pathways

Pathway id	Pathway name
hsa04210	Apoptosis
hsa03410	Base excision repair

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881