• Gene id: 100129969

Gene Summary

• Gene Symbol: FAM205C   Gene   UCSC   Ensembl
• Aliases: FAM205CP
• Gene name: family with sequence similarity 205 member C
• Alternate names: protein FAM205C, FAM205C pseudogene, family with sequence similarity 205, member C, pseudogene, protein FAM205CP, putative family with sequence similarity 205, member C protein, transmembrane protein C9orf144B pseudogene,
• Gene location: 9p13.3 (34895763: 34889065)     Exons: 5     NC_000009.12
• OMIM: 0

Protein Summary

• Protein general information: A6NFA0  
  • Name: Protein FAM205C (FAM205C pseudogene)
  • Length: 338  
  • Mass: 37613
• Sequence:

  MLSPTFVLWDVGYPLYTYGSICIIALIIWQVKKSCQKLSLVPNRSCCRCHRRVQQKSGDRTSRARRTSQEEAEKL
  WKLLFLMKSQGWLPQEGSVRRILCADPCCQICNVMALEIKQLLAGENNQISLTSLGPSQGSSCLEALSTSSVSFK
  HSQDLGSPKSKELSLASVTPTLSQLMDQKSLTQSAARSAGADSVQDSWADHFQRGQRSQVPAVSQVMGSLSSNFE
  KPGIPLSQQERTKNNSKFVLENQEAPEVGLDNKMKLFLHWINPEMKDRRHEESILLSKAETVTQDRTKNIEKSPT
  VTKDHVWGATTQKTTEDPEAQPPSTEEEGLIFCDAPSA

• Structural information:
  • Interpro: IPR027970  
• Other Databases: GeneCards:  FAM205C  Malacards:  FAM205C

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0016020	membrane	IEA	cellular component
GO:0016021	integral component of membrane	IEA	cellular component
GO:0016020	membrane	IEA	cellular component

Diseases

Associated diseases	References
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)